“Swine Flu Hemagglutinin”: amino acid sequence as ambient music
Swine flu has been sequenced. More out of curiosity than anything else, I wrote code to translate a key gene into a piece of ambient music:
“Swine Flu Hemagglutinin” (MP3)
The algorithm I used is a bit complicated, but just in case you’re curious: since the gene is expressed as a surface protein antibodies can sense, it’s considered as a string of amino acids. Each beat corresponds to one amino acid, and the piece is in 3/4 time, so each six measures would correspond to five turns around the alpha structure. (I’m weaseling because I haven’t the foggiest idea how the protein actually gets folded.) Amino acids with side chains that are neither aromatic not aliphatic control the piano and organ: the nine non-hydrophobics the piano, and the four hydrophobics the organ. The three amino acids with aliphatic side chains control the low synthesizer, while the four with aromatics control the percussion.
ש
Update 2009-04-30: For folks coming in from the cnn.com article Making music out of swine flu and wondering about the line, “Zielinski saw it as a form of highly organized information that a human did not design.”: Yes, that phrasing raises the question of who or what I think DID design it. (God? Aliens?) In reality, self-organizing systems evince great complexity without need for a conscious designer. Swine flu was not designed at all– it evolved.
Strictly speaking, this is a version of swine flu hemagglutinin, FJ966952. The actual amino acid sequence:
MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS LVLVVSLGAISFWMCSNGSLQCRICI
Maggie Koerth-Baker’s excellent article from 2009 April 28, “Swine Flu Q&A”, is available here:
Maggie Koerth-Baker, “Swine Flu Q&A”, at boingboing.net
April 28th, 2009 at 9:47 PM
[...] The algorithm I used is a bit complicated, but just in case you’re curious: since the gene is expressed as a surface protein antibodies can sense, it’s considered as a string of amino acids. Each beat corresponds to one amino acid, and the piece is in 3/4 time, so each six measures would correspond to five turns around the alpha structure. (I’m weaseling because I haven’t the foggiest idea how the protein actually gets folded.) Amino acids with side chains that are neither aromatic not aliphatic control the piano and organ: the nine non-hydrophobics the piano, and the four hydrophobics the organ. The three amino acids with aliphatic side chains control the low synthesizer, while the four with aromatics control the percussion. Strictly speaking, this is a version of swine flu hemagglutinin, FJ966952 # [...]
April 29th, 2009 at 12:44 AM
[...] does exactly what it says on the tin. Stephan Zielinski has set swine flu to music: The algorithm I used is a bit complicated, but just in case you’re curious: since the gene is [...]
April 29th, 2009 at 1:34 AM
[...] proprio volete la trovate qui Swine Flu Hemagglutinin (indossate una mascherina prima di [...]
April 29th, 2009 at 1:56 AM
[...] Listen: The Swine Flu Sings! (About it here.) [...]
April 29th, 2009 at 6:30 AM
[...] steer you to the site of Stephan Zielinski, who turned the amino acid sequence of swine flu into a work of ambiant music, which is far more relaxing than anything I’ve heard on the teevee news [...]
April 29th, 2009 at 7:32 AM
[...] “Swine Flu Hemagglutinin”: amino acid sequence as ambient music [...]
April 29th, 2009 at 2:04 PM
[...] Stephan Zielinski did the only thing you can do when you’re faced with the possibility of a deadly disease ravaging the earth’s entire population, he turned its DNA code into ambient music. Now we’ll be able to hear what’s killing us… [...]
April 29th, 2009 at 5:01 PM
[...] 6. “I Have Taken The Amino Acid Sequence of H1N1 Swine Flu and Turned It Into a Piece of Ambient Music. Does This Interest You?” Yes, Stephan Zielinski. Yes, it does. You can listen to Stephan’s appropriately haunting, sad and beautiful composition on his Web site. [...]
April 29th, 2009 at 5:55 PM
[...] Listen to the Swine Flu amino acid sequence as music. IF you’re not worried that simply hearing it will infect you. [...]
April 30th, 2009 at 1:44 AM
[...] “Swine Flu Hemagglutinin”: amino acid sequence as ambient music (via Waxy) [...]
April 30th, 2009 at 4:04 AM
[...] Hype um die Schweinegrippe haben kann. Die einen komponieren Lieder aus der DNA-Sequenz des Virus (klick!), andere basteln mehr oder weniger unterhaltsame Browser-Spielchen aus der Thematik, wie zum [...]
April 30th, 2009 at 6:06 AM
[...] Flu Put To Music Stephen Zielinski has way too much time on his hands for his own good and has written an algorithm to match the amino [...]
April 30th, 2009 at 6:55 AM
[...] Click here to rock out to swine flu – before it sends you to the toilet puking your guts out. Share and Enjoy: [...]
April 30th, 2009 at 7:11 AM
[...] Posted April 30, 2009 at 11:11 am I’ve been listening to this song all morning on repeat, and it has not yet lost any of it’s creepiness. It is the Swine flu gene, somehow mapped out so that all the little oogies and whatsits that make up it’s very DNA are assigned a musical note, and this is the result. (Get more info at his blog). [...]
April 30th, 2009 at 8:17 AM
[...] more here: “Swine Flu Hemagglutinin”: amino acid sequ… Share and [...]
April 30th, 2009 at 8:25 AM
[...] as ambient music | Stephan Zielinski: Dwa 2009 April 30 tags: Music, Swine Flu by depatty “Swine Flu Hemagglutinin”: amino acid sequence as ambient music | Stephan Zielinski: Dwa Swine flu has been sequenced. More out of curiosity than anything else, I wrote code to translate a [...]
April 30th, 2009 at 1:00 PM
[...] 1. Swine Flu Music: The swine flue genome has been sequenced. And a techie named Stephan Zielinski turned it into music. It’s fascinating how something so terrible can sound so beautiful. His blog has more details. [...]
April 30th, 2009 at 1:58 PM
[...] [...]
April 30th, 2009 at 3:32 PM
[...] Swine Flu Hemagglutinin Ambient [...]
April 30th, 2009 at 7:29 PM
[...] The music of H1N1 [...]
May 1st, 2009 at 11:08 PM
[...] "Música" a partir del código genético de la gripe porcina [eng]stephan-zielinski.com/dwa/2009/04/28/swine-flu-ha-as-ambient… por K-M hace pocos segundos [...]
May 2nd, 2009 at 12:01 AM
[...] within the H1N1 vein, Stephan Zielinski has taken an amino acid sequence from the swine flu virus and translated it into ambient music (via [...]
May 2nd, 2009 at 7:19 AM
[...] flu (2), music (38), pig (2) Morceau basé sur la séquence du virus de la grippe porcine : http://stephan-zielinski.com/dwa/2009/04/28/swine-flu-ha-as-ambient-music/ [...]
May 4th, 2009 at 12:38 AM
[...] the results are always interesting. Want a weird example? They have sequenced the Swine Flu and someone has made music from the primary gene using the following rule: The algorithm I used is a bit complicated, but just [...]
May 4th, 2009 at 3:53 PM
[...] How does swine flu sound as a piece of ambient music? Well, a bit like Enya, [...]
May 4th, 2009 at 8:09 PM
[...] Listen: The Swine Flu Sings! (About it here.) [...]
May 5th, 2009 at 4:02 AM
[...] sequenced the flu’s genetic code, and then translated that into music! You can visit his blog to both download the track and find out more about how he did. The end of the world never sounded [...]
May 5th, 2009 at 12:18 PM
[...] The tune is oddly haunting and pleasent in my opinion. You can listen to the tune at the artists website. Category: Science in the News | Comment (RSS) [...]
May 5th, 2009 at 3:44 PM
[...] flu. Don’t ask me to explain the code he used (if you would be interested check it out on his blog), but if you wan’t to know what swine flu sounds like besides rattling noises, listen to [...]
May 6th, 2009 at 5:59 AM
[...] then there’s the really fun stuff: Stephan Zielinski applying the amino acid sequence for Influenza A H1N1 to ambient music. Gizmodo posting a hauntingly beautiful video demonstration of how the virus gets released. [...]
May 7th, 2009 at 8:53 AM
[...] http://stephan-zielinski.com/dwa/2009/04/28/swine-flu-ha-as-ambient-music/ [...]
May 7th, 2009 at 10:28 AM
[...] Interesting work by Stephan Zielinski: [...]
May 8th, 2009 at 6:02 AM
[...] “Swine Flu Hemagglutinin”: amino acid sequence as ambient music | Stephan Zielinski: Dwa (tags: music genetics) [...]
May 8th, 2009 at 12:18 PM
[...] “Swine Flu Hemagglutinin”: amino acid sequence as ambient music http://stephan-zielinski.com/dwa/2009/04/28/swine-flu-ha-as-ambient-music/ [...]
May 12th, 2009 at 7:34 AM
[...] временем заболевания трансформируются в музыку, как и мы, должно быть, переходим в свиней. [...]
May 12th, 2009 at 5:08 PM
[...] the outbreak is to get the genetic sequence. San Francisco blogger Stephan Zielinski decided to see what it sounds like. He wrote an algorith to translate the genetic sequence of H1N1 to sound so we can all listen to [...]